PDB entry 5vx1

View 5vx1 on RCSB PDB site
Description: Bak L100A
Class: apoptosis
Keywords: Apoptosis, Bcl-2 Family, Mutant
Deposited on 2017-05-23, released 2017-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2 homologous antagonist/killer
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7, CDN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611 (6-End)
      • expression tag (4-5)
      • engineered mutation (83)
      • engineered mutation (149)
    Domains in SCOPe 2.08: d5vx1a1, d5vx1a2
  • Chain 'B':
    Compound: bcl-2 homologous antagonist/killer
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7, CDN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611 (6-End)
      • expression tag (3-5)
      • engineered mutation (83)
      • engineered mutation (149)
    Domains in SCOPe 2.08: d5vx1b1, d5vx1b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vx1A (A:)
    gplgsmseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgr
    qlaiigddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgy
    rlalhvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vx1A (A:)
    smseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlai
    igddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgyrlal
    hvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vx1B (B:)
    gplgsmseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgr
    qlaiigddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgy
    rlalhvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vx1B (B:)
    gsmseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqla
    iigddinrrydsefqtmlqhaqptaenayeyftkiatslfesginwgrvvallgfgyrla
    lhvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaaln