PDB entry 5vwq

View 5vwq on RCSB PDB site
Description: E.coli Aspartate aminotransferase-(1R,3S,4S)-3-amino-4-fluorocyclopentane-1-carboxylic acid (FCP)
Class: transferase
Keywords: Aspartate aminotransferase, PMP, Mechanism-based inactivator, (1R, 3S, 4S)-3-amino-4-fluorocyclopentane-1-carboxylic acid (FCP), TRANSFERASE
Deposited on 2017-05-22, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vwqa_
  • Chain 'D':
    Compound: aspartate aminotransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vwqd_
  • Chain 'G':
    Compound: aspartate aminotransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vwqg_
  • Chain 'J':
    Compound: aspartate aminotransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vwqj_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vwqA (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vwqD (D:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vwqG (G:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vwqJ (J:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl