PDB entry 5vwn

View 5vwn on RCSB PDB site
Description: Triosephosphate isomerases deletion loop 3 from Trichomonas vaginalis
Class: isomerase
Keywords: isomerase, loop deletion
Deposited on 2017-05-22, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_096350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vwna_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vwnA (A:)
    mrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkdwkv
    saenvftkpngtvpmiksfgiewtilghserrdilkeddeflaakakfalengmkiiycc
    gehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemc
    kvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasleagfinivn
    snvhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vwnA (A:)
    mrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkdwkv
    saenvvpmiksfgiewtilghsddeflaakakfalengmkiiyccgehlsereagkasef
    vsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemckvirdilaakvgadi
    ankvrilyggsvkpnncnelaacpdvdgflvggasleagfinivnsnvhsk