PDB entry 5vwg

View 5vwg on RCSB PDB site
Description: Galectin-8 N terminal domain in complex with Methyl 3-O-[1-carboxyethyl]-beta-D-galactopyranoside
Class: sugar binding protein
Keywords: carbohydrate binding protein, galectin-8N terminal domain, galectin-8N in complex with designed ligand, Methyl 3-O-[1-carboxyehtyl]-b-D-galactopyranoside, SUGAR BINDING PROTEIN
Deposited on 2017-05-21, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5vwga_
  • Heterogens: 9QG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vwgA (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vwgA (A:)
    lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
    prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
    hrigpekidtlgiygkvnihsigfsfs