PDB entry 5vwe

View 5vwe on RCSB PDB site
Description: Solution NMR structure of the HMG domain of human FACT complex subunit SSRP1
Class: transcription
Keywords: Hitone chaperone, Transcription, DNA replication, DNA damage response, human FACT complex, SSRP1, NMR spectroscopy
Deposited on 2017-05-21, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FACT complex subunit SSRP1
    Species: Homo sapiens [TaxId:9606]
    Gene: SSRP1, FACT80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5vwea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vweA (A:)
ghmsaymlwlnasrekiksdhpgisitdlskkageiwkgmskekkeewdrkaedarrdye
kamkeyegg

    Sequence, based on observed residues (ATOM records): (download) 
    >5vweA (A:)
msaymlwlnasrekiksdhpgisitdlskkageiwkgmskekkeewdrkaedarrdyeka
mkeyegg