PDB entry 5vu0

View 5vu0 on RCSB PDB site
Description: Crystal structure of the complex between afucosylated/galactosylated human IgG1 Fc and Fc gamma receptor IIIa (CD16A) with Man5 N-glycans
Class: immune system
Keywords: Complex, glycosylated, IMMUNE SYSTEM
Deposited on 2017-05-18, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vu0a1, d5vu0a2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vu0b1, d5vu0b2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot H0Y755 (0-171)
      • engineered mutation (35)
      • engineered mutation (71)
      • engineered mutation (155)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d5vu0c1, d5vu0c2
  • Heterogens: NAG, BMA, MAN, GAL, EDO, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vu0A (A:)
    pcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhna
    ktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepq
    vytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsffly
    skltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vu0A (A:)
    pcpapllggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnak
    tkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqv
    ytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vu0B (B:)
    pcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhna
    ktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepq
    vytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsffly
    skltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vu0B (B:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnak
    tkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqv
    ytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vu0C (C:)
    tdlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaat
    vddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
    ylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vu0C (C:)
    tdlpkavvflepqwyrvlekdsvtlkcqqstqwfhneslissqassyfidaatvddsgey
    rcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkg
    rkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititq