PDB entry 5vtx

View 5vtx on RCSB PDB site
Description: Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant apo form
Class: viral protein
Keywords: Influenza A virus, hemagglutinin, mutant, receptor binding, VIRAL PROTEIN
Deposited on 2017-05-18, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-322)
      • expression tag (2-3)
      • engineered mutation (218-219)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d5vtxa1, d5vtxa2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d5vtxb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (218-219)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d5vtxc1, d5vtxc2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d5vtxd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (218-219)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d5vtxe1, d5vtxe2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d5vtxf_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vtxA (A:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxA (A:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekqtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vtxB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vtxC (C:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxC (C:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vtxD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vtxE (E:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxE (E:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vtxF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtxF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf