PDB entry 5vtt

View 5vtt on RCSB PDB site
Description: Dehaloperoxidase B Y38F mutant
Class: oxidoreductase
Keywords: mutant, peroxidase, peroxygenase, globin, OXIDOREDUCTASE
Deposited on 2017-05-18, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV7 (0-136)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5vtta_
  • Chain 'B':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV7 (0-136)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5vttb_
  • Heterogens: HEM, OXY, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vttA (A:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknfvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vttB (B:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknfvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk