PDB entry 5vtm

View 5vtm on RCSB PDB site
Description: The crystal structure of minor pseudopilin ternary complex of XcpVWX from the Type 2 secretion system of Pseudomonas aeruginosa
Class: transport protein
Keywords: Type 2 secretion system, TRANSPORT PROTEIN
Deposited on 2017-05-17, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Compound: Type II secretion system protein I
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: xcpV, pddC, PA3099
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Type II secretion system protein J
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: xcpW, pddD, PA3098
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vtmw_
  • Chain 'X':
    Compound: Type II secretion system protein K
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: xcpX, PA3097
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5vtmW (W:)
    eqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnplgq
    arsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghw
    ptdegseeerleslplavemtlehrhygklvrvwrlldpplkqdqpqgqpggengengeg
    gvpqppegmpgape
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtmW (W:)
    eqrmrelvramgalerdltqaverpvrdelgdnrgaflsegenqiveftrggwrnplgqa
    rsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwp
    tdegseeerleslplavemtlehrhygklvrvwrlldpplk
    

  • Chain 'X':
    No sequence available.