PDB entry 5vtd

View 5vtd on RCSB PDB site
Description: Crystal Structure of the Co-bound Human Heavy-Chain Ferritin variant 122H-delta C-star
Class: oxidoreductase
Keywords: Oxidoreductase, Node, Maxi-ferritin
Deposited on 2017-05-16, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • variant (85)
      • variant (89)
      • variant (101)
      • variant (121)
      • variant (129)
    Domains in SCOPe 2.07: d5vtda_
  • Heterogens: CO, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vtdA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vtdA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg