PDB entry 5vt8

View 5vt8 on RCSB PDB site
Description: Crystal Structure of Mouse Cadherin-23 EC24-25
Class: cell adhesion
Keywords: hearing, mechanotransduction, adhesion, calcium-binding protein, cell adhesion
Deposited on 2017-05-15, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vt8a1, d5vt8a2
  • Chain 'B':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vt8b1, d5vt8b2
  • Chain 'C':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vt8c1, d5vt8c2
  • Chain 'D':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vt8d1, d5vt8d2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vt8A (A:)
    mdcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmds
    glvttqrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhi
    keeiplrsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldre
    kqavyslilvasdlgqpvpyetmqplqvaledilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt8A (A:)
    dcrpqfskpqfstsvyenepagtsvitmlatdqdsqltyslegpgmeafsvdmdsglvtt
    qrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhikeeip
    lrsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldrekqavy
    slilvasdlgqpvpyetmqplqvaledi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vt8B (B:)
    mdcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmds
    glvttqrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhi
    keeiplrsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldre
    kqavyslilvasdlgqpvpyetmqplqvaledilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt8B (B:)
    dcrpqfskpqfstsvyenepagtsvitmlatdqsqltyslegpgmeafsvdmdsglvttq
    rplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhikeeipl
    rsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldrekqavys
    lilvasdlgqpvpyetmqplqvaledi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vt8C (C:)
    mdcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmds
    glvttqrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhi
    keeiplrsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldre
    kqavyslilvasdlgqpvpyetmqplqvaledilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt8C (C:)
    dcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmdsg
    lvttqrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhik
    eeiprsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldrekq
    avyslilvasdlgqpvpyetmqplqvaledi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vt8D (D:)
    mdcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmds
    glvttqrplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhi
    keeiplrsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqrldre
    kqavyslilvasdlgqpvpyetmqplqvaledilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt8D (D:)
    dcrpqfskpqfstsvyenepagtsvitmlatdqsqltyslegpgmeafsvdmdsglvttq
    rplqsyerfnltvvatdggepplwgttmllvevidvndnrpvfvrppngtilhikeeipl
    rsnvyevyatdndeglngavrysflkttgnrdweyftidpisgliqtaqvyslilvasdl
    gqpvpyetmqplqva