PDB entry 5vrl

View 5vrl on RCSB PDB site
Description: crystal structure of the inha from mycobacterium tuberculosis in complex with an12855, ebsi 4333.
Class: oxidoreductase
Keywords: inha, enoyl-acyl reductase, tuberculosis, oxidoreductase
Deposited on 2017-05-11, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: inhA, MT1531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vrla_
  • Heterogens: 9JA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vrlA (A:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vrlA (A:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggeagaqiqlleegwdqrapigwnmkdatpvaktvcal
    lsdwlpattgdiiyadggahtqll