PDB entry 5vrb

View 5vrb on RCSB PDB site
Description: Crystal structure of a transketolase from Neisseria gonorrhoeae
Class: transferase
Keywords: transketolase, TPP, thiamine, thiamine pyrophosphate, calcium-dependent, NIAID, structural genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2017-05-10, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: NGK_0759
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vrba1, d5vrba2, d5vrba3
  • Chain 'B':
    Compound: transketolase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: NGK_0759
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vrbb1, d5vrbb2, d5vrbb3
  • Chain 'C':
    Compound: transketolase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: NGK_0759
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vrbc1, d5vrbc2, d5vrbc3
  • Chain 'D':
    Compound: transketolase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: NGK_0759
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vrbd1, d5vrbd2, d5vrbd3
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vrbA (A:)
    mahhhhhhmsqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfy
    nrdrfvlsnghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgp
    lgqgianavgmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlgl
    gklivlyddnnisidgkvdgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraet
    gkpsiiccktligkgsankegshkthgaplgadeieatrkhlgwaypafeipqeiydawn
    akekgakleagwnelfaqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcakaetv
    atrkasqnsieilakelpelvggsadltpsnltdwsnsvsvtrdkggnyihygvrefgmg
    aimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthdsiglgedgpthqp
    ieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqnlkfqarseqqlnd
    ikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpstsvfdrqdaa
    yqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkafgftvdnvv
    dtvksvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vrbA (A:)
    sqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfynrdrfvlsn
    ghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgplgqgianav
    gmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlglgklivlydd
    nnigwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraetgkpsiiccktleatrk
    hlgwaypafeipqeiydawnakekgakleagwnelfaqyqakypaeaaefvrrmdkklpe
    nfdeyvqtalkevcakaetvatrkasqnsieilakelpelvggsadltpsnltdwsnsvs
    vtrdkggnyihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmkinp
    vfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsc
    lifsrqnlkfqarseqqlndikrgayviseaqgnaqaviiatgsevglaveaqkvlagqg
    iavrvvsmpstsvfdrqdaayqaavlpeglpriaveaghtngwykyvglngavvginrfg
    esapadllfkafgftvdnvvdtvksvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vrbB (B:)
    mahhhhhhmsqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfy
    nrdrfvlsnghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgp
    lgqgianavgmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlgl
    gklivlyddnnisidgkvdgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraet
    gkpsiiccktligkgsankegshkthgaplgadeieatrkhlgwaypafeipqeiydawn
    akekgakleagwnelfaqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcakaetv
    atrkasqnsieilakelpelvggsadltpsnltdwsnsvsvtrdkggnyihygvrefgmg
    aimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthdsiglgedgpthqp
    ieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqnlkfqarseqqlnd
    ikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpstsvfdrqdaa
    yqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkafgftvdnvv
    dtvksvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vrbB (B:)
    sqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfynrdrfvlsn
    ghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgplgqgianav
    gmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlglgklivlydd
    nnisidgkvdgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraetgkpsiicck
    tligkgsankegshkthgaplgadeieatrkhlgwaypafeipqeiydawnakekgakle
    agwnelfaqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcakqnsieilakelpe
    lvggsadltpsnltdwsnsvsvtrdkggnyihygvrefgmgaimnglvlhggvkpfgatf
    lmfseyernalrmaalmkinpvfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpc
    dtaeslvawaeaakaedhpsclifsrqnfqarseqqlndikrgayviseaqgnaqaviia
    tgsevglaveaqkvlagqgiavrvvsmpstsvfdrqdaayqaavlpeglpriaveaghtn
    gwykyvglngavvginrfgesapadllfkafgftvdnvvdtvksvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vrbC (C:)
    mahhhhhhmsqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfy
    nrdrfvlsnghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgp
    lgqgianavgmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlgl
    gklivlyddnnisidgkvdgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraet
    gkpsiiccktligkgsankegshkthgaplgadeieatrkhlgwaypafeipqeiydawn
    akekgakleagwnelfaqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcakaetv
    atrkasqnsieilakelpelvggsadltpsnltdwsnsvsvtrdkggnyihygvrefgmg
    aimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthdsiglgedgpthqp
    ieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqnlkfqarseqqlnd
    ikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpstsvfdrqdaa
    yqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkafgftvdnvv
    dtvksvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vrbC (C:)
    sqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfynrdrfvlsn
    ghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgplgqgianav
    gmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlglgklivlydd
    nndgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraetgkpsiiccktlaplie
    atrkhlgwaypafeipqeiydawnakekgakleagwnelfaqyqakypaeaaefvrrmdk
    klpenfdeyvqtalkevcaknsieilakelpelvggsadltpsnltdwsnsvsvtrdkgg
    nyihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthd
    siglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqa
    rseqqlndikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpsts
    vfdrqdaayqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkaf
    gftvdnvvdtvksvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vrbD (D:)
    mahhhhhhmsqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfy
    nrdrfvlsnghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgp
    lgqgianavgmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlgl
    gklivlyddnnisidgkvdgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraet
    gkpsiiccktligkgsankegshkthgaplgadeieatrkhlgwaypafeipqeiydawn
    akekgakleagwnelfaqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcakaetv
    atrkasqnsieilakelpelvggsadltpsnltdwsnsvsvtrdkggnyihygvrefgmg
    aimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthdsiglgedgpthqp
    ieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqnlkfqarseqqlnd
    ikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpstsvfdrqdaa
    yqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkafgftvdnvv
    dtvksvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vrbD (D:)
    msqlanvirflsadavqkansghpgapmgmaemaetlwtkflnhnpanpkfynrdrfvls
    nghasmllysllhltgynlsiedlknfrqlhsktpghpeygytdgvetttgplgqgiana
    vgmalaekilaaefnkdglnivdhytyvfmgdgclmegvsheacslagtlglgklivlyd
    dndgwftenipqrfesygwhvvpnvnghdtaaiqtaieaaraetgkpsiiccktligkgs
    ankegshkthgaplgadeieatrkhlgwaypafeipqeiydawnakekgakleagwnelf
    aqyqakypaeaaefvrrmdkklpenfdeyvqtalkevcaknsieilakelpelvggsadl
    tpsnltdwsnsvsvtrdkggnyihygvrefgmgaimnglvlhggvkpfgatflmfseyer
    nalrmaalmkinpvfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpcdtaeslva
    waeaakaedhpsclifsrqnlkfqarseqqlndikrgayviseaqgnaqaviiatgsevg
    laveaqkvlagqgiavrvvsmpstsvfdrqdaayqaavlpeglpriaveaghtngwykyv
    glngavvginrfgesapadllfkafgftvdnvvdtvksvl