PDB entry 5vr0

View 5vr0 on RCSB PDB site
Description: Crystal structure of glucose isomerase from Streptomyces rubiginosus
Class: ISOMERASE,Oxidoreductase
Keywords: ISOMERASE(INTRAMOLECULAR OXIDOREDUCTASE), radiation damage, ISOMERASE, Oxidoreductase
Deposited on 2017-05-09, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces rubiginosus [TaxId:1929]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vr0a_
  • Heterogens: MRD, MN, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vr0A (A:)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vr0A (A:)
    nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
    gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
    vdaaaargmaferldqlamdhllgarg