PDB entry 5vq3

View 5vq3 on RCSB PDB site
Description: Nitrogenase Cp1 at pH 6.5
Class: oxidoreductase
Keywords: Nitrogenase, Molybdenum-iron protein, MoFe protein, Cp1, OXIDOREDUCTASE
Deposited on 2017-05-07, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vq3a_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vq3b_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vq3c_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vq3d_
  • Heterogens: HCA, ICS, CLF, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vq3A (A:)
    msenlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckg
    vvmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggv
    nklkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgv
    sqsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatl
    tgdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdma
    kcfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgv
    dslvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkka
    gvplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskq
    lhsydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vq3A (A:)
    nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm
    gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl
    kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs
    aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd
    atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf
    ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl
    vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp
    lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs
    ydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vq3B (B:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vq3C (C:)
    msenlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckg
    vvmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggv
    nklkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgv
    sqsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatl
    tgdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdma
    kcfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgv
    dslvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkka
    gvplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskq
    lhsydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vq3C (C:)
    nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm
    gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl
    kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs
    aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd
    atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf
    ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl
    vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp
    lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs
    ydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vq3D (D:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr