PDB entry 5vp9

View 5vp9 on RCSB PDB site
Description: Crystal structure of HCV NS3/4A protease in complex with AM-07, an analogue of 5172-mcP1P3
Class: hydrolase/hydrolase inhibitor
Keywords: NS3/4a Protease, Hepatitis C virus, Drug Resistance, protease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-05-04, released 2017-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS4A cofactor -- NS3 protein chimera
    Species: Hepatitis C virus subtype 1a [TaxId:31646]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8DG50 (10-20)
      • expression tag (3-9)
      • engineered mutation (11)
      • engineered mutation (18-19)
      • linker (21-22)
    • Uniprot A8DG50 (23-End)
      • engineered mutation (23)
      • engineered mutation (33-34)
      • engineered mutation (37-38)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (67)
      • engineered mutation (72)
      • engineered mutation (92)
      • engineered mutation (106)
      • engineered mutation (179)
    Domains in SCOPe 2.08: d5vp9a1, d5vp9a2
  • Heterogens: 9H7, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vp9A (A:)
gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavs
trgvakavdfipveslettmrsp

    Sequence, based on observed residues (ATOM records): (download) 
    >5vp9A (A:)
masmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqt
flatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgss
dlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstrg
vakavdfipveslettmr