PDB entry 5vp7

View 5vp7 on RCSB PDB site
Description: Crystal structure of human KRAS G12A mutant in complex with GDP
Class: hydrolase
Keywords: Oncogenic mutant, HYDROLASE
Deposited on 2017-05-04, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GTPase KRas
  Species: Homo sapiens [TaxId:9606]
  Gene: KRAS, KRAS2, RASK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01116 (1-169)
    • expression tag (0)
    • engineered mutation (12)
    • engineered mutation (118)
  Domains in SCOPe 2.07: d5vp7a1, d5vp7a2
• Chain 'F':
  Compound: GTPase KRas
  Species: Homo sapiens [TaxId:9606]
  Gene: KRAS, KRAS2, RASK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01116 (1-169)
    • expression tag (0)
    • engineered mutation (12)
    • engineered mutation (118)
  Domains in SCOPe 2.07: d5vp7f1, d5vp7f2
• Heterogens: GDP, MG, PGE, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vp7A (A:)
  hmteyklvvvgaagvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
  gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
  lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vp7F (F:)
  hmteyklvvvgaagvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
  gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
  lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek