PDB entry 5vo4

View 5vo4 on RCSB PDB site
Description: Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With 5-(2-fluoro-4-hydroxyphenyl)-1-methyl-1H-pyrrole-2-carbonitrile
Class: hormone receptor
Keywords: receptor, small molecule inhibitor, HORMONE RECEPTOR
Deposited on 2017-05-02, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vo4a_
  • Heterogens: 9FG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vo4A (A:)
    qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
    vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
    lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
    tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
    kvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vo4A (A:)
    qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
    vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
    lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiaptscsr
    rfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpi
    yfhtq