PDB entry 5vnx

View 5vnx on RCSB PDB site
Description: Crystal structure of an 8-amino-7-oxononanoate synthase from Burkholderia multivorans with a potential glycine-PLP-Lys242 cyclized intermediate or byproduct
Class: transferase
Keywords: SSGCID, Burkholderia multivorans, 8-amino-7-oxononanoate synthase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2017-05-01, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: bioF, Bmul_0373, BMULJ_02881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vnxa_
  • Chain 'B':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: bioF, Bmul_0373, BMULJ_02881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vnxb_
  • Chain 'C':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: bioF, Bmul_0373, BMULJ_02881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vnxc_
  • Heterogens: BEN, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vnxA (A:)
    mnlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklva
    afaegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaav
    talagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdt
    vfsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtl
    gxaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrah
    laaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvp
    agtsrlrislsaahsfddlarletallraseea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vnxB (B:)
    mnlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklva
    afaegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaav
    talagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdt
    vfsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtl
    gxaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrah
    laaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvp
    agtsrlrislsaahsfddlarletallraseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vnxB (B:)
    nlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklvaa
    faegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaavt
    alagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdtv
    fsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtlg
    xaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrahl
    aaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvpa
    gtsrlrislsaahsfddlarletallraseea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vnxC (C:)
    mnlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklva
    afaegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaav
    talagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdt
    vfsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtl
    gxaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrah
    laaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvp
    agtsrlrislsaahsfddlarletallraseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vnxC (C:)
    nlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklvaa
    faegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaavt
    alagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdtv
    fsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtlg
    xaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrahl
    aaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvpa
    gtsrlrislsaahsfddlarletallraseea