PDB entry 5vnu

View 5vnu on RCSB PDB site
Description: Nonheme Iron Replacement in a Biosynthetic Nitric Oxide Reductase Model Performing O2 Reduction to Water: Mn-bound FeBMb
Class: oxygen transport
Keywords: oxygen, reduction, biosynthetic, myoglobin, OXYGEN TRANSPORT
Deposited on 2017-05-01, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (42)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d5vnua_
  • Heterogens: HEM, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vnuA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
    lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg