PDB entry 5vmk

View 5vmk on RCSB PDB site
Description: Crystal structure of a bifunctional GlmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1- phosphate N-acetyltransferase from Acinetobacter baumannii
Class: transferase
Keywords: NIAID, cSMRT, citrate, structural genomics, mutli-domain protein, bifunctional protein, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2017-04-27, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: glmU, ABUW_0090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmka1, d5vmka2
  • Chain 'B':
    Compound: Bifunctional protein glmU
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: glmU, ABUW_0090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmkb1, d5vmkb2
  • Chain 'C':
    Compound: Bifunctional protein glmU
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: glmU, ABUW_0090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmkc1, d5vmkc2
  • Heterogens: CIT, PO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vmkA (A:)
    mahhhhhhmsttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiy
    ghggdhvkktfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttle
    qlievsnktgigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycv
    snaklhewlpklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaal
    erefqkqqakelmqqgvtfadparfdlrgtvkvghdvridvnviiegncelgdfveigag
    cilknttiaagtkvqaysvfdgavvgentqigpfarlrpgaklanevhignfvevkntti
    glgskanhftylgdaeigaesnigagtitcnydgankhkttigdavfigsnsslvapvti
    gngatvgagsvitkdvaeqslsferaqqiskanyqrpqklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmkA (A:)
    sttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkk
    tfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttleqlievsnkt
    gigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycvsnaklhewl
    pklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaalerefqkqqa
    kelmqqgvtfadparfdlrgtvkvghdvridvnviiegncelgdfveigagcilknttia
    agtkvqaysvfdgavvgentqigpfarlrpgaklanevhignfvevknttiglgskanhf
    tylgdaeigaesnigagtitcnydgankhkttigdavfigsnsslvapvtigngatvgag
    svitkdvaeqslsferaqqiskanyqrpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vmkB (B:)
    mahhhhhhmsttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiy
    ghggdhvkktfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttle
    qlievsnktgigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycv
    snaklhewlpklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaal
    erefqkqqakelmqqgvtfadparfdlrgtvkvghdvridvnviiegncelgdfveigag
    cilknttiaagtkvqaysvfdgavvgentqigpfarlrpgaklanevhignfvevkntti
    glgskanhftylgdaeigaesnigagtitcnydgankhkttigdavfigsnsslvapvti
    gngatvgagsvitkdvaeqslsferaqqiskanyqrpqklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmkB (B:)
    ttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkkt
    faqeniqwveqgtghavqmtlpvlgislilygdvplvrqttleqlievsnktgigmitlh
    vdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycvsnaklhewlpyyltdiv
    amavadgleiasiqpelafevegvndrlqlaalerefqkqqakelmqqgvtfadparfdl
    rgtvkvghdvridvnviiegncelgdfveigagcilknttiaagtkvqaysvfdgavvge
    ntqigpfarlrpgaklanevhignfvevknttiglgskanhftylgdaeigaesnigagt
    itcnydgankhkttigdavfigsnsslvapvtigngatvgagsvitkdvaeqslsferaq
    qiskanyqrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vmkC (C:)
    mahhhhhhmsttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiy
    ghggdhvkktfaqeniqwveqaeqlgtghavqmtlpvlpkdgislilygdvplvrqttle
    qlievsnktgigmitlhvdnptgygrivrqdgkiqaivehkdateaqrqiqeintgiycv
    snaklhewlpklsnenaqgeyyltdivamavadgleiasiqpelafevegvndrlqlaal
    erefqkqqakelmqqgvtfadparfdlrgtvkvghdvridvnviiegncelgdfveigag
    cilknttiaagtkvqaysvfdgavvgentqigpfarlrpgaklanevhignfvevkntti
    glgskanhftylgdaeigaesnigagtitcnydgankhkttigdavfigsnsslvapvti
    gngatvgagsvitkdvaeqslsferaqqiskanyqrpqklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmkC (C:)
    sttviilaagkgtrmrsqlpkvlqplagrpllghviktakqllaeniitiyghggdhvkk
    tfaqeniqwveqagtghavqmtlpislilygdvplvrqttleqlievsnktgigmitlhv
    dnptgygrikiqaivehkdateaqrqiqeintgiycvsnaklhewlpklsmavadiasiq
    pelafevegvndrlqlaalerefqkqqakelmqqgvtfadparfdlrgtvkvghdvridv
    nviiegncelgdfveigagcilknttiaagtkvqaysvfdgavvgentqigpfarlrpga
    klanevhignfvevknttiglgskanhftylgdaeigaesnigagtitcnydgankhktt
    igdavfigsnsslvapvtigngatvgagsvitkdvaeqslsfeqqiskanyqrpq