PDB entry 5vmc

View 5vmc on RCSB PDB site
Description: Influenza hemagglutinin H1 mutant DH1 in complex with 6'SLN
Class: viral protein
Keywords: influenza, hemagglutinin, receptor, VIRAL PROTEIN
Deposited on 2017-04-27, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmca_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmcb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmcc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmcd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmce_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vmcf_
  • Heterogens: NAG, BMA, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vmcA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vmcB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvkles
    mgvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vmcC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vmcD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvkles
    mgvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vmcE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
    pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdtit
    featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
    ecpkyvrstklrmatglrnip
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vmcF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvkles
    mgvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vmcF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkys