PDB entry 5vm6

View 5vm6 on RCSB PDB site
Description: The hapten triclocarban bound to the single domain camelid nanobody VHH T10
Class: unknown function
Keywords: nanobody, triclocarban, UNKNOWN FUNCTION
Deposited on 2017-04-26, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM6
    Domains in SCOPe 2.07: d5vm6a1, d5vm6a2
  • Heterogens: SO4, 9EG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vm6A (A:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm6A (A:)
    vklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwya
    dsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgq
    gtqvtvssh