PDB entry 5vm4

View 5vm4 on RCSB PDB site
Description: The apo form of the triclocarban-binding single domain camelid nanobody VHH T10
Class: unknown function
Keywords: nanobody, triclocarban, UNKNOWN FUNCTION
Deposited on 2017-04-26, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4a1, d5vm4a2
  • Chain 'B':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4b1, d5vm4b2
  • Chain 'C':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4c1, d5vm4c2
  • Chain 'D':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4d1, d5vm4d2
  • Chain 'E':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4e1, d5vm4e2
  • Chain 'F':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4f1, d5vm4f2
  • Chain 'G':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4g1, d5vm4g2
  • Chain 'H':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4h1, d5vm4h2
  • Chain 'I':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4i1, d5vm4i2
  • Chain 'J':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4j1, d5vm4j2
  • Chain 'K':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4k1, d5vm4k2
  • Chain 'L':
    Compound: single domain camelid nanobody VHH T10
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM4
    Domains in SCOPe 2.07: d5vm4l1, d5vm4l2
  • Heterogens: ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vm4A (A:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4A (A:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vm4B (B:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4B (B:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vm4C (C:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4C (C:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vm4D (D:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4D (D:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vm4E (E:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4E (E:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vm4F (F:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4F (F:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5vm4G (G:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4G (G:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5vm4H (H:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4H (H:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5vm4I (I:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4I (I:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5vm4J (J:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4J (J:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5vm4K (K:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4K (K:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vm4L (L:)
    maqvklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdt
    wyadsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypy
    wgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm4L (L:)
    klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
    svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
    tqvtvsshhhhh