PDB entry 5vm0

View 5vm0 on RCSB PDB site
Description: The hapten triclocarban bound to the single domain camelid nanobody VHH T9
Class: unknown function
Keywords: nanobody, triclocarban, UNKNOWN FUNCTION
Deposited on 2017-04-26, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camelid Nanobody VHH T9
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM0
    Domains in SCOPe 2.07: d5vm0a_
  • Chain 'B':
    Compound: Camelid Nanobody VHH T9
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VM0 (Start-127)
    Domains in SCOPe 2.07: d5vm0b_
  • Heterogens: EDO, 9EG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vm0A (A:)
    maevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgta
    ayadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgt
    qvtvsspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm0A (A:)
    aevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgtaa
    yadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgtq
    vtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vm0B (B:)
    maevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgta
    ayadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgt
    qvtvsspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vm0B (B:)
    aevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgtaa
    yadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgtq
    vtvsspg