PDB entry 5vlv

View 5vlv on RCSB PDB site
Description: The apo form of the triclocarban-binding single domain camelid nanobody VHH T9
Class: unknown function
Keywords: nanobody, triclocarban, UNKNOWN FUNCTION
Deposited on 2017-04-26, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Camelid Nanobody VHH T9
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VLV
    Domains in SCOPe 2.07: d5vlva1, d5vlva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vlvA (A:)
    maevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgta
    ayadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgt
    qvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vlvA (A:)
    aevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgtaa
    yadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgtq
    vtvss