PDB entry 5vl5

View 5vl5 on RCSB PDB site
Description: Coordination Chemistry within a Protein Host: Regulation of the Secondary Coordination Sphere
Class: biotin binding protein
Keywords: streptavidin, biotin, copper, azide, secondary coordination sphere, hydrogen bond, BIOTIN BINDING PROTEIN
Deposited on 2017-04-24, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
    Domains in SCOPe 2.08: d5vl5a1, d5vl5a2
  • Heterogens: S31, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vl5A (A:)
masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
kstlvghdtftkvkpsaasidaakkagvnngnpldavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >5vl5A (A:)
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v