PDB entry 5vkx

View 5vkx on RCSB PDB site
Description: Coordination Chemistry within a Protein Host: Regulation of the Secondary Coordination Sphere
Class: biotin binding protein
Keywords: streptavidin, biotin, copper, azide, secondary coordination sphere, hydrogen bond, BIOTIN BINDING PROTEIN
Deposited on 2017-04-24, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (11-12)
    Domains in SCOPe 2.08: d5vkxa1, d5vkxa2
  • Heterogens: S18, CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vkxA (A:)
masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
kstlvghdtftkvkpsaasidaakkagvnngnpldavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >5vkxA (A:)
rdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
kvk