PDB entry 5vki

View 5vki on RCSB PDB site
Description: Crystal structure of P[19] rotavirus VP8* complexed with mucin core 2
Class: viral protein
Keywords: complex, P[19]VP8*, mucin core 2, VIRAL PROTEIN
Deposited on 2017-04-21, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vkia_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vkib_
  • Heterogens: SO4, GOL, THR, NGA, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vkiA (A:)
vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vkiB (B:)
vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl