PDB entry 5vki

View 5vki on RCSB PDB site
Description: Crystal structure of P[19] rotavirus VP8* complexed with mucin core 2
Class: viral protein
Keywords: complex, P[19]VP8*, mucin core 2, VIRAL PROTEIN
Deposited on 2017-04-21, released 2017-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5vkia_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5vkib_
  • Heterogens: SO4, GOL, THR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vkiA (A:)
    vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vkiB (B:)
    vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl