PDB entry 5vkh

View 5vkh on RCSB PDB site
Description: Closed conformation of KcsA Y82A-F103A mutant
Class: immune system/transport protein
Keywords: KcsA, closed, Y82A-F103A, potassium channel, IMMUNE SYSTEM-TRANSPORT PROTEIN complex
Deposited on 2017-04-21, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VKH (0-218)
    Domains in SCOPe 2.07: d5vkha1, d5vkha2, d5vkha3
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VKH (0-211)
    Domains in SCOPe 2.07: d5vkhb1, d5vkhb2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-102)
      • engineered mutation (60)
      • conflict (68)
      • engineered mutation (81)
    Domains in SCOPe 2.07: d5vkhc_
  • Heterogens: F09, 1EM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vkhA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vkhB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vkhC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    apvtlwgrcvavvvmvagitsaglvtaalatwfvgreqerrgh