PDB entry 5vkg

View 5vkg on RCSB PDB site
Description: Solution-state NMR structural ensemble of human Tsg101 UEV in complex with tenatoprazole
Class: cell cycle/inhibitor
Keywords: ESCRT-I, inhibitor, cell cycle, cell cycle-inhibitor complex
Deposited on 2017-04-21, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vkga_
  • Heterogens: 4N1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vkgA (A:)
    gavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
    vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
    qsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vkgA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp