PDB entry 5vkd

View 5vkd on RCSB PDB site
Description: Crystal structure of C-terminal domain of Ebola (Bundibugyo) nucleoprotein in complex with Fab fragment
Class: immune system
Keywords: Ebolavirus, Nucleoprotein, Fab, antibody fragment, IMMUNE SYSTEM
Deposited on 2017-04-21, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Bundibugyo ebolavirus [TaxId:565995]
    Database cross-references and differences (RAF-indexed):
    • Uniprot R4QJ68 (4-102)
      • expression tag (1-3)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VKD (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VKD (Start-214)
    Domains in SCOPe 2.07: d5vkdl1, d5vkdl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vkdL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vkdL (L:)
    iqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsr
    fsgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkveikrtvaapsvfifpps
    dsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec