PDB entry 5vjm

View 5vjm on RCSB PDB site
Description: Crystal structure of H7 hemagglutinin mutant (V186K, K193T, G228S) from the influenza virus A/Shanghai/2/2013 (H7N9) with LSTa
Class: viral protein
Keywords: influenza virus, hemagglutinin, mutant, receptor specificity, VIRAL PROTEIN
Deposited on 2017-04-19, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot R4NN21
      • engineered mutation (180)
      • engineered mutation (187)
      • engineered mutation (222)
    Domains in SCOPe 2.07: d5vjma_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vjmb_
  • Heterogens: NAG, SIA, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vjmA (A:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    kstaeqttlygsgnklvtvgssnyqqsfvpspgarpqvnglssridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjmA (A:)
    iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
    ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
    ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhskstaeq
    ttlygsgnklvtvgssnyqqsfvpspgarpqvnglssridfhwlmlnpndtvtfsfngaf
    iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
    rslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vjmB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjmB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri