PDB entry 5vjf

View 5vjf on RCSB PDB site
Description: Class II fructose-1,6-bisphosphate aldolase of Helicobacter pylori with DHAP
Class: lyase
Keywords: Glycolysis, Metalloenzyme, Lyase
Deposited on 2017-04-19, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • engineered mutation (47)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5vjfa_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • engineered mutation (47)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5vjfb_
  • Heterogens: ZN, NA, CA, GOL, 13P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vjfA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjfA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldf
    erlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvn
    tdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vjfB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjfB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldf
    erlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvn
    tdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki