PDB entry 5vje

View 5vje on RCSB PDB site
Description: Class II fructose-1,6-bisphosphate aldolase of Escherichia coli with D-glucitol 1,6-bisphosphate
Class: lyase
Keywords: Glycolysis, Lyase
Deposited on 2017-04-19, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vjea_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vjeb_
  • Heterogens: NA, GOS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vjeA (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjeA (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
    edvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkhnlphnsl
    nfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkg
    edqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vjeB (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjeB (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgclyt
    qpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkhnlphn
    slnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnp
    kgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl