PDB entry 5vja

View 5vja on RCSB PDB site
Description: Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38)
Class: transferase/transferase inhibitor
Keywords: death-associated protein kinase 3, transferase, inhibitor, smooth muscle contraction, transferase-transferase inhibitor complex
Deposited on 2017-04-19, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK3, ZIPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43293 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vjaa1, d5vjaa2
  • Chain 'B':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK3, ZIPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43293 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vjab1, d5vjab2
  • Chain 'C':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK3, ZIPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43293 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vjac1, d5vjac2
  • Chain 'D':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK3, ZIPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43293 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vjad1, d5vjad2
  • Heterogens: DMS, DUK, ILE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vjaA (A:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevn
    ilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildg
    vhylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvap
    eivnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntse
    lakdfirrllvkdpkrrmtiaqslehswikairrrnvrgedsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjaA (A:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrrgvsreeierevnilrei
    rhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildgvhylh
    skriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvapeivny
    eplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdf
    irrllvkdpkrrmtiaqslehswika
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vjaB (B:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevn
    ilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildg
    vhylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvap
    eivnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntse
    lakdfirrllvkdpkrrmtiaqslehswikairrrnvrgedsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjaB (B:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrgvsreeierevnilreir
    hpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildgvhylhs
    kriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvapeivnye
    plgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfi
    rrllvkdpkrrmtiaqslehswikai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vjaC (C:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevn
    ilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildg
    vhylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvap
    eivnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntse
    lakdfirrllvkdpkrrmtiaqslehswikairrrnvrgedsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjaC (C:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlssgvsreeierevnilr
    eirhpniitlhdifenktdvvlilelvsggelfdfekesltedeatqflkqildgvhylh
    skriahfdlkpenimlldvpnpriklidfgiahkieagnefknifgtpefvapeivnyep
    lgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfir
    rllvkdpkrrmtiaqslehswikai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vjaD (D:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevn
    ilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildg
    vhylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvap
    eivnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntse
    lakdfirrllvkdpkrrmtiaqslehswikairrrnvrgedsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vjaD (D:)
    smvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsvsreeierevnilrei
    rhpniitlhdifenktdvvlilelvsggelfdekesltedeatqflkqildgvhylhskr
    iahfdlkpenimlldvpnpriklidfgiahkieagnefknifgtpefvapeivnyeplgl
    eadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfirrll
    vkdpkrrmtiaqslehswika