PDB entry 5vj5

View 5vj5 on RCSB PDB site
Description: Horse Liver Alcohol Dehydrogenase Complexed with 1,10-Phenanthroline
Class: oxidoreductase
Keywords: alcohol dehydrogenase, 1, 10-phenanthroline, zinc chelation, liver, apoenzyme, OXIDOREDUCTASE
Deposited on 2017-04-18, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vj5a1, d5vj5a2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vj5b1, d5vj5b2
  • Heterogens: ZN, PHN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vj5A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vj5B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf