PDB entry 5vj3

View 5vj3 on RCSB PDB site
Description: HIV Protease (PR) in open form with Mg2+ in active site and HIVE-9 in eye site
Class: hydrolase
Keywords: protease, allostery, fragment binding, eye site, HYDROLASE
Deposited on 2017-04-18, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Q8V9 (0-98)
      • conflict (6)
      • conflict (32)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.07: d5vj3a_
  • Heterogens: HV9, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vj3A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf