PDB entry 5vix

View 5vix on RCSB PDB site
Description: Crystal structure of Polyubiquitin with 3 ub domains, domains 1 and 2, from Neisseria gonorrhoeae
Class: unknown function
Keywords: SSGCID, Structural Genomics, Naegleria fowleri, polyubiquitin, Seattle Structural Genomics Center for Infectious Disease, UNKNOWN FUNCTION
Deposited on 2017-04-17, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin
    Species: Naegleria gruberi [TaxId:5762]
    Gene: NAEGRDRAFT_55791, NAEGRDRAFT_56056
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2V6G7 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d5vixa1, d5vixa2, d5vixa3
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vixA (A:)
    mahhhhhhmqifvktltgktitlevesndtienvkskiqdkegippdqqrlifagkqled
    grtlsdyniqkestlhlvlrlrggmqifvktltgktitlevesndtienvkskiqdkegi
    ppdqqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vixA (A:)
    hhhhmqifvktltgktitlevesndtienvkskiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevesndtienvkskiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlr