PDB entry 5viu

View 5viu on RCSB PDB site
Description: Crystal Structure of Acetylornithine Aminotransferase from Elizabethkingia anophelis
Class: transferase
Keywords: SSGCID, Acetylornithine aminotransferase, Elizabethkingia anophelis, argD, L-arginine biosynthesis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2017-04-17, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine aminotransferase
    Species: Elizabethkingia anophelis [TaxId:1117645]
    Gene: argD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5viua_
  • Chain 'B':
    Compound: Acetylornithine aminotransferase
    Species: Elizabethkingia anophelis [TaxId:1117645]
    Gene: argD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5viub_
  • Heterogens: EDO, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5viuA (A:)
    mahhhhhhmsetknseyfieleekhgahnyhplpvvldrgegvfvwdvegkkyydflsay
    savnqghshpkivealveqasklaltsrafynsklgeyeqkitsllgfdkvlpmnsgaea
    vetavklarkwsyevkgiaenaakiivcennfhgrtttivsfsndpdanqnygpftpgfi
    ripyndiaaleevlskeagniaaflvepiqgeagvyvpnegflkqsselckkhnvlfiad
    evqtgiartgkliachhedvqpdililgkalsggmypvsavlannnimdvikpgqhgstf
    ggnplacavamaaldvvqdeklseraeklgnlfrseiekliektdlitkvrgkgllnail
    indtpdsstawnlclalkengllakpthgniirlapplviteeqlldcvkiiektilef
    

    Sequence, based on observed residues (ATOM records): (download)
    >5viuA (A:)
    tknseyfieleekhgahnyhplpvvldrgegvfvwdvegkkyydflsaysavnqghshpk
    ivealveqasklaltsrafynsklgeyeqkitsllgfdkvlpmnsgaeavetavklarkw
    syevkgiaenaakiivcennfhgrtttifsndpdgpftpgfiripyndiaaleevlskea
    gniaaflvepiqgeagvyvpnegflkqsselckkhnvlfiadevqtgiartgkliachhe
    dvqpdililgkalsggmypvsavlannnimdvikpgqhgstfggnplacavamaaldvvq
    deklseraeklgnlfrseiekliektdlitkvrgkgllnailindtpdsstawnlclalk
    engllakpthgniirlapplviteeqlldcvkiiektilef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5viuB (B:)
    mahhhhhhmsetknseyfieleekhgahnyhplpvvldrgegvfvwdvegkkyydflsay
    savnqghshpkivealveqasklaltsrafynsklgeyeqkitsllgfdkvlpmnsgaea
    vetavklarkwsyevkgiaenaakiivcennfhgrtttivsfsndpdanqnygpftpgfi
    ripyndiaaleevlskeagniaaflvepiqgeagvyvpnegflkqsselckkhnvlfiad
    evqtgiartgkliachhedvqpdililgkalsggmypvsavlannnimdvikpgqhgstf
    ggnplacavamaaldvvqdeklseraeklgnlfrseiekliektdlitkvrgkgllnail
    indtpdsstawnlclalkengllakpthgniirlapplviteeqlldcvkiiektilef
    

    Sequence, based on observed residues (ATOM records): (download)
    >5viuB (B:)
    tknseyfieleekhgahnyhplpvvldrgegvfvwdvegkkyydflsaysavnqghshpk
    ivealveqasklaltsrafynsklgeyeqkitsllgfdkvlpmnsgaeavetavklarkw
    syevkgiaenaakiivcentpgfiripyndiaaleevlskeagniaaflvepiqgeagvy
    vpnegflkqsselckkhnvlfiadevqtgiartgkliachhedvqpdililgkalsggmy
    pvsavlannnimdvikpgqhgstfggnplacavamaaldvvqdeklseraeklgnlfrse
    iekliektdlitkvrgkgllnailindtpdsstawnlclalkengllakpthgniirlap
    plviteeqlldcvkiiektilef