PDB entry 5vh6

View 5vh6 on RCSB PDB site
Description: 2.6 Angstrom Resolution Crystal Structure of N-terminal Fragment (residues 1-406) of Elongation Factor G from Bacillus subtilis.
Class: hydrolase,oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Elongation Factor G, HYDROLASE, OXIDOREDUCTASE
Deposited on 2017-04-12, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: fusA, fus, BSU01120
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80868 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5vh6a1, d5vh6a2, d5vh6a3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vh6A (A:)
    snamarefslektrnigimahidagktttterilfytgrihkigethegasqmdwmeqeq
    ergititsaattaqwkgyrvniidtpghvdftveverslrvldgavavldaqsgvepqte
    tvwrqattygvprivfvnkmdkigadflysvgtlrdrlqanahaiqlpigaednfegiid
    lvenvayfyeddlgtrsdakeipeeykeqaeelrnslieavceldeelmdkylegeeiti
    delkagirkgtlnvefypvlvgsafknkgvqlvldavldylpaptdvaaikgtrpdtnee
    ierhssdeepfsalafkvmtdpyvgkltffrvysgtldsgsyvknstkgkrervgrilqm
    hansreeistvyagdiaaavglkdtttgdtlcdekdlvilesmefpepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vh6A (A:)
    amarefslektrnigimahidagktttterilfytgriitsaattaqwkgyrvniidtpg
    hvdftveverslrvldgavavldaqsgvepqtetvwrqattygvprivfvnkmdkigadf
    lysvgtlrdrlqanahaiqlpigaednfegiidlvenvayfyeddlgtrsdakeipeeyk
    eqaeelrnslieavceldeelmdkylegeeitidelkagirkgtlnvefypvlvgsafkn
    kgvqlvldavldylpaptdvaaikgtrpdtneeierhssdeepfsalafkvmtdpyvgkl
    tffrvysgtldsgsyvknstkgkrervgrilqmhansreeistvyagdiaaavglkdttt
    gdtlcdekdlvilesm