PDB entry 5vgu

View 5vgu on RCSB PDB site
Description: Structure of Halothece sp. PCC 7418 CcmK4
Class: structural protein
Keywords: Bacterial Microcompartment, STRUCTURAL PROTEIN
Deposited on 2017-04-11, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vgua_
  • Chain 'B':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vgub_
  • Chain 'C':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vguc_
  • Chain 'D':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vgud_
  • Chain 'E':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vgue_
  • Chain 'F':
    Compound: Microcompartments protein
    Species: Halothece sp. PCC 7418 [TaxId:65093]
    Gene: PCC7418_0347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vguf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vguA (A:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguA (A:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfrest
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vguB (B:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguB (B:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vguC (C:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguC (C:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfrest
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vguD (D:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguD (D:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfrest
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vguE (E:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguE (E:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vguF (F:)
    msldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamda
    gihavdkaygaaletwviiprphenvecvlpiaynenverfresterpligssqnrswsh
    pqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vguF (F:)
    sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
    ihavdkaygaaletwviiprphenvecvlpiaynenverfrest