PDB entry 5vg1

View 5vg1 on RCSB PDB site
Description: Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase
Class: sugar binding protein
Keywords: histidine brace, HYDROLASE, SUGAR BINDING PROTEIN
Deposited on 2017-04-10, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: NEUT
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chitinase
  Species: Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) [TaxId:471856]
  Gene: Jden_1381
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7R4I0 (0-141)
  Domains in SCOPe 2.07: d5vg1a_
• Chain 'B':
  Compound: chitinase
  Species: Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) [TaxId:471856]
  Gene: Jden_1381
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7R4I0 (0-141)
  Domains in SCOPe 2.07: d5vg1b_
• Heterogens: CU, PER, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vg1A (A:)
  hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
  tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
  larwnvsntnnafyncmdvvvs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vg1B (B:)
  hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
  tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
  larwnvsntnnafyncmdvvvs