PDB entry 5vfm

View 5vfm on RCSB PDB site
Description: Crystal structure of BnSP-7 from Bothrops pauloensis complexed with p-coumaric acid
Class: hydrolase
Keywords: Lys49-PLA2, Bothrops pauloensis, p-coumaric acid, HYDROLASE
Deposited on 2017-04-08, released 2017-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Basic phospholipase A2 homolog BnSP-7
  Species: Bothrops pauloensis [TaxId:1042543]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9IAT9 (1-120)
    • insertion (0)
    • conflict (1)
  Domains in SCOPe 2.08: d5vfma1, d5vfma2
• Chain 'B':
  Compound: Basic phospholipase A2 homolog BnSP-7
  Species: Bothrops pauloensis [TaxId:1042543]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9IAT9 (1-120)
    • insertion (0)
    • conflict (1)
  Domains in SCOPe 2.08: d5vfmb1, d5vfmb2
• Heterogens: ME2, SO4, HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vfmA (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vfmB (B:)
  slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c