PDB entry 5vfj

View 5vfj on RCSB PDB site
Description: Crystal structure of BnSP-7 from bothrops pauloensis complexed with caffeic acid
Class: hydrolase
Keywords: Lys49-PLA2, Bothrops pauloensis, Caffeic acid, HYDROLASE
Deposited on 2017-04-07, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog BnSP-7
    Species: Bothrops pauloensis [TaxId:1042543]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (2-120)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vfja1, d5vfja2
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog BnSP-7
    Species: Bothrops pauloensis [TaxId:1042543]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (2-120)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vfjb1, d5vfjb2
  • Heterogens: SO4, DHC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vfjA (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vfjB (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c