PDB entry 5vfg

View 5vfg on RCSB PDB site
Description: Synaptotagmin 1 C2B domain, lead-bound (high occupancy)
Class: metal binding protein
Keywords: metal binding protein, c2b domain
Deposited on 2017-04-07, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Synaptotagmin-1
  Species: Mus musculus [TaxId:10090]
  Gene: Syt1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46096 (0-150)
    • engineered mutation (6)
  Domains in SCOPe 2.07: d5vfga_
• Heterogens: PB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5vfgA (A:)
  eklgdisfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
  kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
  sdmlanprrpiaqwhtlqveeevdamlavkk