PDB entry 5vff

View 5vff on RCSB PDB site
Description: Synaptotagmin 1 C2B domain, lead-bound (low occupancy)
Class: metal binding protein
Keywords: metal binding protein, c2b domain
Deposited on 2017-04-07, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Syt1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46096 (0-150)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d5vffa_
  • Heterogens: PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vffA (A:)
    eklgdisfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
    kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
    sdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vffA (A:)
    eklgdisfslryvptagkltvvileaknlkkmdvlsdpyvkihlmqngkrlkkkkttikk
    ntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhwsd
    mlanprrpiaqwhtlqveeevdamlavkk