PDB entry 5vfe

View 5vfe on RCSB PDB site
Description: Synaptotagmin 1 C2A domain, lead-bound
Class: metal binding protein
Keywords: metal binding protein, c2a domain
Deposited on 2017-04-07, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Syt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vfea_
  • Chain 'B':
    Compound: Synaptotagmin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Syt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vfeb_
  • Heterogens: PB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vfeA (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vfeA (A:)
    klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
    tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
    dlqsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vfeB (B:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vfeB (B:)
    klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
    tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
    dlqs