PDB entry 5vfa

View 5vfa on RCSB PDB site
Description: RitR Mutant - C128D
Class: transcription
Keywords: Repressor of iron transporter, Aspartate-less receiver domain protein, Transcription regulator, monomer, Transcription
Deposited on 2017-04-07, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Streptococcus pneumoniae (strain ATCC BAA-255 / R6) [TaxId:171101]
    Gene: csrR, spr0336
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DR53 (Start-228)
      • expression tag (229)
    Domains in SCOPe 2.08: d5vfaa1, d5vfaa2, d5vfaa3
  • Chain 'B':
    Compound: Response regulator
    Species: Streptococcus pneumoniae (strain ATCC BAA-255 / R6) [TaxId:171101]
    Gene: csrR, spr0336
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DR53 (Start-228)
      • expression tag (229)
    Domains in SCOPe 2.08: d5vfab1, d5vfab2, d5vfab3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vfaA (A:)
    mgkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmm
    aqdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrg
    rdfidqhdslmkvprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreq
    llesvwkyesatetnivdvyirylrskldvkgqksyiktvrgvgytmqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vfaA (A:)
    gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
    qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
    dfidprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwkye
    stetnivdvyirylrskldvkgqksyiktvrgvgytmqeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vfaB (B:)
    mgkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmm
    aqdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrg
    rdfidqhdslmkvprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreq
    llesvwkyesatetnivdvyirylrskldvkgqksyiktvrgvgytmqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vfaB (B:)
    gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
    qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
    dfidqhrtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwky
    esatetnivdvyirylrskldvkgqksyiktvrgvgytmqeg